PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS71020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family WOX
Protein Properties Length: 165aa    MW: 18557.9 Da    PI: 7.0156
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS71020.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.63.2e-2184144257
                 T--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox   2 rkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57 
                 r+R+++t++ql++Le++F +   +ps+++++e++ +l    +++e++V++WFqNrRa+ k+
  EPS71020.1  84 RQRWNPTPKQLQILEQMFDQgIGTPSKQKIKEITLELcqhgQISETNVYNWFQNRRARSKR 144
                 89*****************99**************************************97 PP

2Wus_type_Homeobox103.31.7e-3384146365
  Wus_type_Homeobox   3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65 
                        r+RW+Ptp+Q++iLe+++++G+ tP+k++i++it eL ++G+i+++NV++WFQNr+aR+++kq
         EPS71020.1  84 RQRWNPTPKQLQILEQMFDQGIGTPSKQKIKEITLELCQHGQISETNVYNWFQNRRARSKRKQ 146
                        79***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-1680148IPR009057Homeodomain-like
PROSITE profilePS5007114.36680145IPR001356Homeobox domain
SMARTSM003892.0E-1182149IPR001356Homeobox domain
SuperFamilySSF466893.68E-1882149IPR009057Homeodomain-like
PfamPF000465.2E-1984144IPR001356Homeobox domain
CDDcd000867.68E-1384146No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MEPPPPDEGG EMMFVKVMTD EQIEILRKQI SVYAAICEQL VDLHKSMTDL AAGGGVGGGL  60
SNHHHHHHLY CDASSGGAHK ISGRQRWNPT PKQLQILEQM FDQGIGTPSK QKIKEITLEL  120
CQHGQISETN VYNWFQNRRA RSKRKQQQVG VMNKDESDVE SQNQA
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1137145RRARSKRKQ
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00669PBMTransfer from GRMZM2G038252Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099896.16e-65PREDICTED: WUSCHEL-related homeobox 8
SwissprotQ5QMM35e-59WOX8_ORYSJ; WUSCHEL-related homeobox 8
TrEMBLS8CW231e-122S8CW23_9LAMI; Uncharacterized protein
STRINGGLYMA10G43580.25e-62(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA56752437
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35550.17e-54WUSCHEL related homeobox 13
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]